DDX49 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-69713
• Prices: $299.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to DDX49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49) The peptide sequence was selected from the N terminal of DDX49. Peptide sequence ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: DDX49
• Conjugate: Unconjugated