TMEM63A Antibody
| Name | TMEM63A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69249 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TMEM63A(transmembrane protein 63A) The peptide sequence was selected from the N terminal of TMEM63A. Peptide sequence MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TMEM63A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TMEM63A Antibody [NBP1-69249] - This Anti-TMEM63A antibody was used in Western Blot of 293T tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14890_TMEM63A%2520Antibody-Western%2520Blot-NBP1-69249-img0001.jpg)
Western Blot: TMEM63A Antibody [NBP1-69249] - This Anti-TMEM63A antibody was used in Western Blot of 293T tissue lysate at a concentration of 1ug/ml.