Epithelial Stromal Interaction 1 Antibody
| Name | Epithelial Stromal Interaction 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69247 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to EPSTI1(epithelial stromal interaction 1 (breast)) The peptide sequence was selected from the N terminal of Epithelial Stromal Interaction 1. Peptide sequence RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | EPSTI1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: epithelial stromal interaction 1 Antibody [NBP1-69247] - This Anti-EPSTI1 antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16537_epithelial%2520stromal%2520interaction%25201%2520Antibody-Western%2520Blot-NBP1-69247-img0001.jpg)
Western Blot: epithelial stromal interaction 1 Antibody [NBP1-69247] - This Anti-EPSTI1 antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.