ZNF257 Antibody

Name ZNF257 Antibody
Supplier Novus Biologicals
Catalog NBP1-69171
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ZNF257 (zinc finger protein 257) The peptide sequence was selected from the C terminal of ZNF257. Peptide sequence HLSQHKIIHTGEKPYKCEECGKPFNRFSYLTVHKRIHAGENPNKYEECGK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZNF257
Conjugate Unconjugated
Supplier Page Shop

Product images