CSN3 Antibody

Name CSN3 Antibody
Supplier Novus Biologicals
Catalog NBP1-69167
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CSN3 (casein kappa) The peptide sequence was selected from the N terminal of CSN3. Peptide sequence MKSFLLVVNALALTLPFLAVEVQNQKQPACHENDERPFYQKTAPYVPMYY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CSN3
Conjugate Unconjugated
Supplier Page Shop

Product images