ZDHHC24 Antibody
| Name | ZDHHC24 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69239 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ZDHHC24(zinc finger, DHHC-type containing 24) The peptide sequence was selected from the middle region of ZDHHC24. Peptide sequence QHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTADVGHTA. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ZDHHC24 |
| Supplier Page | Shop |
Product images
![Western Blot: ZDHHC24 Antibody [NBP1-69239] - This Anti-ZDHHC24 antibody was used in Western Blot of Fetal Small Intestine tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/586_ZDHHC24%2520Antibody-Western%2520Blot-NBP1-69239-img0001.jpg)
Western Blot: ZDHHC24 Antibody [NBP1-69239] - This Anti-ZDHHC24 antibody was used in Western Blot of Fetal Small Intestine tissue lysate at a concentration of 1ug/ml.