LYSMD4 Antibody

Name LYSMD4 Antibody
Supplier Novus Biologicals
Catalog NBP1-69234
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LYSMD4(LysM, putative peptidoglycan-binding, domain containing 4) The peptide sequence was selected from the N terminal of LYSMD4. Peptide sequence PRREQVTWCCCSGSWPRRTASTSWRCSMAANTFYFRPNGAGDTRQNLIPD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LYSMD4
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.