ZNF677 Antibody

Name ZNF677 Antibody
Supplier Novus Biologicals
Catalog NBP1-69213
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ZNF677 (zinc finger protein 677) The peptide sequence was selected from the N terminal of ZNF677. Peptide sequence YRNLLSLDEDNIPPEDDISVGFTSKGLSPKENNKEELYHLVILERKESHG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZNF677
Conjugate Unconjugated
Supplier Page Shop

Product images