SIK3 Antibody

Name SIK3 Antibody
Supplier Novus Biologicals
Catalog NBP1-69207
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KIAA0999 (SIK family kinase 3) The peptide sequence was selected from the middle region of KIAA0999. Peptide sequence LHAQQLLKRPRGPSPLVTMTPAVPAVTPVDEESSDGEPDQEAVQSSTYKD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SIK3
Conjugate Unconjugated
Supplier Page Shop

Product images