RAB6C Antibody

Name RAB6C Antibody
Supplier Novus Biologicals
Catalog NBP1-74265
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to the middle region of RAB6C. Immunizing peptide sequence DVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RAB6C
Conjugate Unconjugated
Supplier Page Shop

Product images