TCEAL8 Antibody

Name TCEAL8 Antibody
Supplier Novus Biologicals
Catalog NBP1-79349
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human TCEAL8The immunogen for this antibody is TCEAL8. Peptide sequence PQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELER.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TCEAL8
Conjugate Unconjugated
Supplier Page Shop

Product images