ZNF429 Antibody
| Name | ZNF429 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79343 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human ZNF429The immunogen for this antibody is ZNF429. Peptide sequence KMYHCDIYVKVFYAFSNADRYKTRHTGKKPFQCKKCGKSFCMLSQLTQHK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF429 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ZNF429 Antibody [NBP1-79343] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15227_ZNF429%2520Antibody-Western%2520Blot-NBP1-79343-img0002.jpg)
Western Blot: ZNF429 Antibody [NBP1-79343] - HepG2 cell lysate, concentration 0.2-1 ug/ml.