ZNF763 Antibody
| Name | ZNF763 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79358 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human ZNF763The immunogen for this antibody is ZNF763. Peptide sequence KDQNIEYEYQNPRRNFRSLIEGNVNEIKEDSHCGETFTQVPDDRLNFQEK. |
| Purity/Format | IgG purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF763 |
| Supplier Page | Shop |
Product images
![Western Blot: ZNF763 Antibody [NBP1-79358] - HepG2 cell lysate, concentration 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/633_ZNF763%2520Antibody-Western%2520Blot-NBP1-79358-img0002.jpg)
Western Blot: ZNF763 Antibody [NBP1-79358] - HepG2 cell lysate, concentration 5.0ug/ml.