CCL13/MCP-4 Antibody
| Name | CCL13/MCP-4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79936 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human CCL13. Peptide sequence KSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CCL13 |
| Supplier Page | Shop |
Product images
![Western Blot: MCP4 Antibody [NBP1-79936] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/634_MCP4%2520Antibody-Western%2520Blot-NBP1-79936-img0002.jpg)
Western Blot: MCP4 Antibody [NBP1-79936] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.