PDCD2L Antibody
| Name | PDCD2L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79403 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human PDCD2LThe immunogen for this antibody is PDCD2L. Peptide sequence FACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGA. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PDCD2L |
| Supplier Page | Shop |
Product images
![Western Blot: PDCD2L Antibody [NBP1-79403] - Hela cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/654_PDCD2L%2520Antibody-Western%2520Blot-NBP1-79403-img0002.jpg)
Western Blot: PDCD2L Antibody [NBP1-79403] - Hela cell lysate, concentration 0.2-1 ug/ml.