ZNF93 Antibody
| Name | ZNF93 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79260 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human ZNF93The immunogen for this antibody is ZNF93. Peptide sequence FNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKRIHTGEKPYKC. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF93 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ZNF93 Antibody [NBP1-79260] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24519_ZNF93-Antibody-Western-Blot-NBP1-79260-img0003.jpg)
Western Blot: ZNF93 Antibody [NBP1-79260] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
![Western Blot: ZNF93 Antibody [NBP1-79260] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24520_ZNF93-Antibody-Western-Blot-NBP1-79260-img0002.jpg)
Western Blot: ZNF93 Antibody [NBP1-79260] - 721_B cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: ZNF93 Antibody [NBP1-79260] - Human MCF7, Antibody Dilution: 1.0 ug/ml ZNF93 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24521_ZNF93%2520Antibody-Western%2520Blot-NBP1-79260-img0004.jpg)
Western Blot: ZNF93 Antibody [NBP1-79260] - Human MCF7, Antibody Dilution: 1.0 ug/ml ZNF93 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.