Name | SETD3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-79446 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptide directed towards the middle region of human SETD3The immunogen for this antibody is SETD3. Peptide sequence AVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLTPEDSFALAVASA. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | SETD3 |
Supplier Page | Shop |