ZNF117 Antibody
| Name | ZNF117 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79243 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human ZNF117The immunogen for this antibody is ZNF117. Peptide sequence QCLKTTLSKIFQCNKYVEVFHKISNSNRHKMRHTENKHFKCKECRKTFCM. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF117 |
| Supplier Page | Shop |
Product images
![Western Blot: ZNF117 Antibody [NBP1-79243] - Titration: 0.2-1 ug/ml Positive Control: HT1080 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/683_ZNF117%2520Antibody-Western%2520Blot-NBP1-79243-img0003.jpg)
Western Blot: ZNF117 Antibody [NBP1-79243] - Titration: 0.2-1 ug/ml Positive Control: HT1080 cell lysate.