MB21D2 Antibody

Name MB21D2 Antibody
Supplier Novus Biologicals
Catalog NBP1-79527
Prices $139.00, $369.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the C terminal of human C3orf59. Peptide sequence QSDGGDPNQPDDRLAKKLQQLVTENPGKSISVFINPDDVTRPHFRIDDKF.
Purity/Format Immunogen affinity purified
Blocking Peptide MB21D2 Peptide
Description Rabbit Polyclonal
Gene MB21D2
Conjugate Unconjugated
Supplier Page Shop

Product images