ADPRM Antibody
| Name | ADPRM Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79668 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human C17orf48The immunogen for this antibody is C17ORF48. Peptide sequence MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ADPRM |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ADPRM Antibody [NBP1-79668] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17282_ADPRM%2520Antibody-Western%2520Blot-NBP1-79668-img0002.jpg)
Western Blot: ADPRM Antibody [NBP1-79668] - HepG2 cell lysate, concentration 0.2-1 ug/ml.