C19orf73 Antibody

Name C19orf73 Antibody
Supplier Novus Biologicals
Catalog NBP1-79663
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human FLJ10490. Peptide sequence VVRPAGFPRRTRLMVRSAPPTQRPPTGSGCVSGLWRKGLGLRPQTLLRVG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C19orf73
Conjugate Unconjugated
Supplier Page Shop

Product images