Apolipoprotein L5 Antibody

Name Apolipoprotein L5 Antibody
Supplier Novus Biologicals
Catalog NBP1-79725
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the C terminal of human APOL5. Peptide sequence: QHHRHLPQKASQTCSSSRGRAVRGSRVVKPEGSRSPLPWPVVEHQPRLGP
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene APOL5
Conjugate Unconjugated
Supplier Page Shop

Product images