beta-Defensin 4/2 Antibody
| Name | beta-Defensin 4/2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79792 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human DEFB4AThe immunogen for this antibody is DEFB4A. Peptide sequence LLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DEFB4A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Defensin beta 4 Antibody [NBP1-79792] - Defensin beta 4 Antibody Human Placenta lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24665_Defensin-beta-4-Antibody-Western-Blot-NBP1-79792-img0003.jpg)
Western Blot: Defensin beta 4 Antibody [NBP1-79792] - Defensin beta 4 Antibody Human Placenta lysate, concentration 0.2-1 ug/ml.