Kv6.4 Antibody

Name Kv6.4 Antibody
Supplier Novus Biologicals
Catalog NBP1-80100
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human KCNG4. Peptide sequence QEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRRP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KCNG4
Conjugate Unconjugated
Supplier Page Shop

Product images