TRIM34 Antibody
| Name | TRIM34 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80050 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human TRIM34. Peptide sequence SMGGKSSCPVCGISYSFEHLQANQHLANIVERLKEVKLSPDNGKKRDLCD. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TRIM34 |
| Supplier Page | Shop |
Product images
![Western Blot: TRIM34 Antibody [NBP1-80050] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/756_TRIM34%2520Antibody-Western%2520Blot-NBP1-80050-img0003.jpg)
Western Blot: TRIM34 Antibody [NBP1-80050] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.