TRIM17 Antibody

Name TRIM17 Antibody
Supplier Novus Biologicals
Catalog NBP1-80044
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the C terminal of human TRIM17. Peptide sequence PKCPENGFWVVQLSKGTKYLSTFSALTPVMLMEPPSHMGIFLDFEAGEVS.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene TRIM17
Conjugate Unconjugated
Supplier Page Shop

Product images