ZNF547 Antibody

Name ZNF547 Antibody
Supplier Novus Biologicals
Catalog NBP1-80056
Prices $299.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human ZNF547. Peptide sequence GTHPEQGLYTCPAHLHQHQKEQIREKLSRGDGGRPTFVKNHRVHMAGKTF.
Purity/Format IgG purified
Description Rabbit Polyclonal
Gene ZNF547
Supplier Page Shop

Product images