ZNF614 Antibody

Name ZNF614 Antibody
Supplier Novus Biologicals
Catalog NBP1-80055
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human ZNF614. Peptide sequence VLSKLAHGQEPWTTDAKIQNKNCPGIGKVDSHLQEHSPNQRLLKSVQQCN.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ZNF614
Supplier Page Shop

Product images