ZNF417 Antibody

Name ZNF417 Antibody
Supplier Novus Biologicals
Catalog NBP1-80160
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human ZNF417. Peptide sequence: SVREASFVKKRKLRVSQEPFVFREFGKDVLPSSGLCQEAAAVEKTDSETM
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZNF417
Conjugate Unconjugated
Supplier Page Shop

Product images