ZNF485 Antibody

Name ZNF485 Antibody
Supplier Novus Biologicals
Catalog NBP1-80146
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the C terminal of human ZNF485. Peptide sequence: SSGLVEHQRLHTGEKPYKCNECGKAFPRSSALKQHKKIHNKERAMKCS
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZNF485
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.