SP140L Antibody
| Name | SP140L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80140 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human LOC93349. Peptide sequence TVDFQAPLLPVTCGGVKGILHKEKLEQGTLAKCIQTEDGKWFTPMEFEIK. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SP140L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SP140L Antibody [NBP1-80140] - Jurkat cell lysate, concentration 2.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15441_SP140L-Antibody-Western-Blot-NBP1-80140-img0003.jpg)
Western Blot: SP140L Antibody [NBP1-80140] - Jurkat cell lysate, concentration 2.5 ug/ml.