ESX1 Antibody
| Name | ESX1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80214 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of mouse ESX1. Peptide sequence MESHKKCPCCYCTDLKTFVGAVKEETLQDPQPSLSSTLLEGADYQENAES. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | Esx1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ESX1 Antibody [NBP1-80214] - Human Testis lysate, concentration 2.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/12687_ESX1%2520Antibody-Western%2520Blot-NBP1-80214-img0002.jpg)
Western Blot: ESX1 Antibody [NBP1-80214] - Human Testis lysate, concentration 2.5 ug/ml.