ZNF610 Antibody

Name ZNF610 Antibody
Supplier Novus Biologicals
Catalog NBP1-80181
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human ZNF610. Peptide sequence: KIYRSNQVEKFTNHRSSVSPLQKISSSFTTHIFNKYRNDLIDFPLLPQEE
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ZNF610
Supplier Page Shop

Product images