ZNF433 Antibody

Name ZNF433 Antibody
Supplier Novus Biologicals
Catalog NBP1-80165
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human ZNF433. Peptide sequence VYGEVGSAHSSLNRHIRDDTGHKAYEYQEYGQKPYKCKYCKKPFNCLSSV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZNF433
Conjugate Unconjugated
Supplier Page Shop

Product images