PDLIM1 Antibody

Name PDLIM1 Antibody
Supplier Novus Biologicals
Catalog NBP1-80239
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptide directed towards the middle region of mouse PDLIM1. Peptide sequence TSASGEEANSRPVVQPHPSGSLIIDKDSEVYKMLQEKQELNEPPKQSTSF.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene Pdlim1
Conjugate Unconjugated
Supplier Page Shop

Product images