ZNF589 Antibody

Name ZNF589 Antibody
Supplier Novus Biologicals
Catalog NBP1-80274
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human ZFP589. Peptide sequence LEIQLSPAQNASSEEVDRISKRAETPGFGAVRFGECALAFNQKSNLFRQK.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene ZNF589
Conjugate Unconjugated
Supplier Page Shop

Product images