ZFP28 Antibody

Name ZFP28 Antibody
Supplier Novus Biologicals
Catalog NBP1-80348
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human ZFP28. Peptide sequence RKTFIQIGHLNQHKRVHTGERSYNYKKSRKVFRQTAHLAHHQRIHTGESS.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ZFP28
Supplier Page Shop

Product images