KLF17 Antibody
| Name | KLF17 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80428 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human KLF17. Peptide sequence YGRPQAEMEQEAGELSRWQAAHQAAQDNENSAPILNMSSSSGSSGVHTSW. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | KLF17 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: KLF17 Antibody [NBP1-80428] - 293T Cell lysate, 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7056_KLF17-Antibody-Western-Blot-NBP1-80428-img0001.jpg)
![Western Blot: KLF17 Antibody [NBP1-80428] - Analysis of HepG2 lysate Cell lysates, Antibody Dilution: 0.2 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7057_KLF17%2520Antibody-Western%2520Blot-NBP1-80428-img0002.jpg)