ZNF431 Antibody

Name ZNF431 Antibody
Supplier Novus Biologicals
Catalog NBP1-80392
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human ZNF431. Peptide sequence TLTKHRKIHTRQKPYNCEECDNTFNQSSNLIKQNNSYWRETLQMSRMWES.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ZNF431
Supplier Page Shop

Product images