ZNF431 Antibody

Name ZNF431 Antibody
Supplier Novus Biologicals
Catalog NBP1-80391
Prices $139.00, $369.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human ZNF431. Peptide sequence MDDLKYGVYPLKEASGCPGAERNLLVYSYFEKETLTFRDVAIEFSLEEWE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZNF431
Conjugate Unconjugated
Supplier Page Shop

Product images