ZNF440 Antibody
| Name | ZNF440 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80404 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human ZNF440. Peptide sequence VNFTQEEWALLDISQRKLYREVMLETFRNLTSLGKRWKDQNIEYEHQNPR. |
| Purity/Format | IgG purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF440 |
| Supplier Page | Shop |
Product images
![Western Blot: ZNF440 Antibody [NBP1-80404] - HepG2 cell lysate, concentration 2.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/858_ZNF440%2520Antibody-Western%2520Blot-NBP1-80404-img0002.jpg)
Western Blot: ZNF440 Antibody [NBP1-80404] - HepG2 cell lysate, concentration 2.5 ug/ml.