GLTPD2 Antibody

Name GLTPD2 Antibody
Supplier Novus Biologicals
Catalog NBP1-80543
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human LOC388323. Peptide sequence LAAMAAWERRAGLLEQPGAAPRDPTRSSGSRTLLLLHRALRWSQLCLHRV.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene GLTPD2
Conjugate Unconjugated
Supplier Page Shop

Product images