FAM26F Antibody

Name FAM26F Antibody
Supplier Novus Biologicals
Catalog NBP1-80539
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human FAM26F. Peptide sequence NRSCAAELPLVPCNQAKASDVQDLLKDLKAQSQVLGWILIAVVIIILLIF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FAM26F
Conjugate Unconjugated
Supplier Page Shop

Product images