SLC35A4 Antibody

Name SLC35A4 Antibody
Supplier Novus Biologicals
Catalog NBP1-80530
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human SLC35A4. Peptide sequence GLALLLLMAAGACYAAGGLQVPGNTLPSPPPAAAASPMPLHITPLGLLLL.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SLC35A4
Supplier Page Shop

Product images