FAM156A Antibody

Name FAM156A Antibody
Supplier Novus Biologicals
Catalog NBP1-80458
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human FAM156A. Peptide sequence DPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMMGLSNLSPGPG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FAM156A
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.