ETV2/ER71 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-97864
• Prices: $139.00, $369.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ELISA
• Species Reactivities: Human
• Antigen: Synthetic peptide directed towards the N terminal of human ETV2. Peptide sequence DTPTATAETCWKGTSSSLASFPQLDWGSALLHPEVPWGAEPDSQALPWSG.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ETV2
• Conjugate: Unconjugated