ZNF284 Antibody

Name ZNF284 Antibody
Supplier Novus Biologicals
Catalog NBP1-91368
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human ZNF284. Peptide sequence TFKCDGCGKRFYMNSQGHSHQRAYREEELYKCQKCGKGYISKFNLDLHQR.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ZNF284
Supplier Page Shop

Product images