SPAG11B Antibody

Name SPAG11B Antibody
Supplier Novus Biologicals
Catalog NBP1-91448
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human SPAG11B. Peptide sequence MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SPAG11B
Conjugate Unconjugated
Supplier Page Shop

Product images