ZNF493 Antibody

Name ZNF493 Antibody
Supplier Novus Biologicals
Catalog NBP1-91547
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human LOC115648. Peptide sequence AGIAVSKPDLVTCLEQGKDPWNMKGHSTVVKPPVETGFHRFSQDGLYLLT.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ZNF493
Supplier Page Shop

Product images