CIITA Antibody
| Name | CIITA Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91543 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Antigen | Synthetic peptide directed towards the C terminal of mouse C2TA. Peptide sequence MALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLVQTQRLRN. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | Ciita |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CIITA Antibody [NBP1-91543] - NIH-3T3 cells lysate, concentration 0.125ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15885_CIITA%2520Antibody-Western%2520Blot-NBP1-91543-img0002.jpg)
Western Blot: CIITA Antibody [NBP1-91543] - NIH-3T3 cells lysate, concentration 0.125ug/ml.